Can molecular weight be calculated from a protein sequence?

Yes. A calculator can sum residue contributions for the exact submitted chain and report an average or monoisotopic mass. State the convention. The result will not automatically include tags, cleavage, post-translational modifications, cofactors, or oligomerization that are absent from the sequence model [1,2].

What is the difference between pI and charge at pH 7?

Theoretical pI is the modeled pH at which net charge is zero. Charge at pH 7 is the modeled net charge at one specific pH. A protein with pI above 7 will often have a positive predicted charge at pH 7, but both values depend on the sequence and ionization model.

Which extinction coefficient should I use: reduced or oxidized?

Use the assumption that matches the cysteine redox state of the sample and document it. The oxidized estimate includes cystine contributions from disulfide bonds; the reduced estimate does not [1-3]. If the redox or disulfide state is unknown, report both as assumptions rather than selecting one silently.

Does theoretical pI predict the best purification buffer?

It can inform an initial buffer and ion-exchange discussion, but it does not select the best condition by itself. Folded structure, local charge, ionic strength, cofactors, modifications, aggregation, resin chemistry, and the required downstream assay also matter. Confirm behavior experimentally.

Should I analyze the precursor or the mature protein sequence?

Analyze the sequence that matches the scientific object. Use the precursor for questions about the translated precursor and the mature chain or recombinant construct for questions about the processed or produced protein. If both matter, calculate both and report their boundaries separately [2].

Are ProteoCalc results experimental measurements?

No. They are deterministic estimates and descriptors derived from the submitted primary sequence with Biopython methods. They are useful for planning and reproducible comparison, but observed mass, absorbance, stability, structure, half-life, and solution behavior require appropriate experiments.

Sequence Bioinformatics For ProteoCalc

How to Calculate Protein Molecular Weight, pI, and Extinction Coefficient from a Sequence

Calculate protein molecular weight, theoretical pI, charge, and extinction coefficient from FASTA while preserving sequence boundaries, assumptions, and evidence limits.

By BioChemIntelli

Published September 1, 2026

A protein-properties calculator can answer useful early questions in seconds: approximately how large is the translated chain, where is its theoretical pI, what is its predicted net charge near neutral pH, and how strongly might its aromatic residues absorb at 280 nm? Those values can support construct planning, buffer discussions, purification calculations, and reproducible reporting.

The common failure is not arithmetic. It is calculating the wrong biological object. A database precursor, a mature chain, a signal-peptide-trimmed construct, and a tagged recombinant protein can all produce different sequence-derived properties while still being described informally by the same protein name.

Define the exact protein sequence first

Sequence questions that change the answer

Question	Why the value can change	What to report
Precursor or mature chain?	Signal peptides, propeptides, and transit peptides add residues that may be absent from the experimental product.	Accession, feature boundaries, and the exact analyzed range.
Native or recombinant construct?	Affinity tags, linkers, cleavage scars, substitutions, and truncations alter composition and mass.	The actual construct sequence, not only the reference-protein name.
Monomer or assembly?	A sequence calculator normally reports one submitted chain; a dimer or larger assembly has a different total mass.	Per-chain result and the separately stated oligomeric assumption.
Unmodified or modified?	Glycosylation, phosphorylation, lipidation, disulfide formation, cofactors, and other modifications are not fully encoded by a plain FASTA sequence.	Sequence-only value plus any independently supported modification model.
Average or monoisotopic mass?	The mass convention changes the number and its appropriate experimental comparison.	Mass convention, software, and units.

ExPASy ProtParam explicitly notes that a sequence-only calculation does not know post-translational modifications or whether the mature protein forms a dimer or multimer [2]. That limitation applies to any similar sequence-derived estimate.

How molecular weight is calculated from sequence

A sequence-based molecular-weight calculation sums the residue contributions for the submitted chain while accounting for the peptide-bonded polymer. Biopython's ProteinAnalysis.molecular_weight() uses the IUPAC average molecular mass by default; its optional monoisotopic mode is a different convention [1]. ProteoCalc currently reports the default average mass in daltons and kilodaltons.

That number should be described as the calculated mass of the entered sequence. A purification construct with a tag, a cleaved mature chain, a disulfide-linked oligomer, or a glycoprotein may differ from it. For mass-spectrometry comparison, explicitly align sequence boundaries, modifications, isotopic convention, and charge-state interpretation with the experimental method.

What theoretical pI and charge at pH 7 mean

The theoretical pI is the pH at which the model estimates a net charge of zero for the submitted sequence. Charge at pH 7 asks a related but different question: what net charge does that model estimate at one specified pH? Biopython exposes both isoelectric_point() and charge_at_pH() [1].

Use pI as a planning variable, not as a guarantee of solubility or purification behavior. Local environment, folded structure, ionic strength, modifications, cofactors, and aggregation can make an experimental protein behave differently from an isolated residue-ionization model. When comparing tools, keep the sequence and pKa model fixed; different algorithms can return slightly different theoretical values.

How the extinction coefficient is estimated

Assumptions behind the 280 nm estimate

Layer	Interpretation	Reporting requirement
Aromatic residues	The estimate is driven primarily by tryptophan and tyrosine contributions at 280 nm [2,3].	State that the coefficient is calculated from sequence composition.
Cysteine state	A disulfide-bonded cystine contributes differently from reduced cysteine, so tools may return reduced and oxidized assumptions [1-3].	Name which value was used and why that redox assumption fits the sample.
Units	The result is normally a molar extinction coefficient in M^-1 cm^-1.	Report units, wavelength, and solvent or measurement context.
Concentration use	Beer-Lambert calculations also require path length and absorbance measured within the instrument's valid range.	Preserve the experimental absorbance, path length, dilution, blank, and selected coefficient.
Model limitation	Sequence-based equations do not represent every chromophore, cofactor, scattering effect, or environmental shift.	Measure the coefficient when the required accuracy or protein chemistry exceeds the model.

Gill and von Hippel calibrated a sequence-composition approach against globular proteins and discussed its assumptions and limitations [3]. ExPASy documents the Tyr, Trp, and cystine terms used in its 280 nm calculation and warns that errors can be larger for proteins without tryptophan [2].

Worked example with the ProteoCalc demonstration sequence

Built-in FASTA example

>sp|P01574|IFNB_HUMAN Interferon beta precursor
MTNKCLLQIALLLCFSTTALSMSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKD
RMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLAN
VYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIV
RVEILRNFYFINRLTGYLRN

Reproducible ProteoCalc output for the 187-residue input

Property	ProteoCalc result	Correct interpretation
Sequence length	187 aa	The complete sequence supplied to the calculator.
Average molecular weight	22,293.63 Da (22.294 kDa)	Calculated mass of that unmodified submitted chain under Biopython's default average-mass convention.
Theoretical pI	8.93	Model-estimated zero-net-charge pH for the submitted sequence.
Predicted charge at pH 7	+4.91	Sequence-model estimate at pH 7, not a direct measurement.
Extinction coefficient, reduced cysteines	31,400 M^-1 cm^-1	Assumes cysteines are reduced.
Extinction coefficient, oxidized cysteines	31,650 M^-1 cm^-1	Assumes cysteine pairs contribute as cystines under the calculator's model.

These values were regenerated with the current ProteoCalc implementation, which calls Biopython ProteinAnalysis. They are an application result, not a claim that a purified interferon beta preparation will have exactly these measured properties.

Interpret the other sequence-derived outputs carefully

Useful descriptors and their evidence boundaries

Descriptor	What it summarizes	What it does not establish
GRAVY	Average hydropathy from a residue scale; Biopython defaults to the Kyte-Doolittle scale [1,5].	Solubility, membrane insertion, aggregation, or expression yield by itself.
Aromaticity	Relative frequency of phenylalanine, tryptophan, and tyrosine in the sequence [1].	Measured absorbance or tertiary packing.
Instability index	A sequence-based dipeptide-composition heuristic originating from a defined training set [1,4].	Universal in vivo or in vitro stability across organisms, constructs, and conditions.
Secondary-structure propensity fractions	Composition-based fractions of residues associated with helix, turn, or sheet propensity [1].	A predicted three-dimensional structure or residue-level secondary-structure assignment.
Flexibility profile	A sliding sequence-based propensity calculation under the implemented scale [1].	Experimental dynamics, disorder, or conformational ensembles.
N-terminal half-life lookup	A coarse estimate based on the first residue and the selected organismal rule.	Measured degradation of a processed protein in a specific cell, compartment, or formulation.

A reproducible calculation workflow

Define the object: decide whether the question concerns the reference precursor, mature chain, domain, recombinant construct, or engineered variant.
Freeze the FASTA: save the exact header, sequence, accession or construct ID, boundaries, and checksum.
Validate symbols: resolve ambiguous or non-standard residues rather than silently deleting them.
Run the calculator: record the application and dependency versions plus the mass convention and pH.
Choose the extinction assumption: report reduced and oxidized results or justify the one used.
Separate output from inference: label calculated values and keep experimental measurements in a different evidence field.
Compare like with like: use identical sequence boundaries and assumptions when comparing variants or tools.

This record is small enough to retain with a construct design, purification worksheet, supplementary method, or laboratory handoff.

Where ProteoCalc fits

ProteoCalc is a free BioChemIntelli web tool for one protein FASTA sequence from 10 to 3,000 amino acids. It uses Biopython ProteinAnalysis to report length, average molecular weight, theoretical pI, charge at pH 7, GRAVY, aromaticity, instability index, reduced and oxidized extinction coefficients, composition-based structural propensities, flexibility, and N-terminal half-life lookups.

ProteoCalc does not identify mature-chain boundaries, model post-translational modifications, determine oligomeric state, measure concentration, predict a complete structure, or validate experimental behavior. The user must submit the biologically relevant sequence and interpret every value within its assumptions.

Open ProteoCalc and preserve the submitted FASTA beside the result.

Frequently asked questions

Bottom line

The most important input to a protein-properties calculation is not the protein name; it is the exact sequence and biological boundary. Once that is fixed, molecular weight, pI, charge, and extinction coefficient become transparent, repeatable estimates. Preserve those assumptions and use experiments for claims about the material that is actually produced.

References

Biopython Project. Bio.SeqUtils.ProtParam module Biopython 1.88 documentation (2026) Official API reference for average molecular mass, pI, charge, GRAVY, aromaticity, instability, flexibility, secondary-structure propensity, and reduced or oxidized extinction coefficients.
Elisabeth Gasteiger, Christine Hoogland, Alexandre Gattiker, Severine Duvaud, Marc R. Wilkins, Ron D. Appel, and Amos Bairoch. ProtParam documentation ExPASy, SIB Swiss Institute of Bioinformatics (2005) Authoritative documentation of sequence-derived properties, extinction assumptions, and limits involving modifications, mature chains, and multimers.
S. C. Gill and P. H. von Hippel. Calculation of Protein Extinction Coefficients from Amino Acid Sequence Data Analytical Biochemistry (1989) DOI: 10.1016/0003-2697(89)90602-7 Original calibration and limitations of sequence-based molar extinction-coefficient calculation.
K. Guruprasad, B. V. B. Reddy, and M. W. Pandit. Correlation Between Stability of a Protein and Its Dipeptide Composition: A Novel Approach for Predicting In Vivo Stability of a Protein from Its Primary Sequence Protein Engineering (1990) Original instability-index method, used here only to explain the evidence boundary of the sequence heuristic.
Jack Kyte and Russell F. Doolittle. A Simple Method for Displaying the Hydropathic Character of a Protein Journal of Molecular Biology (1982) DOI: 10.1016/0022-2836(82)90515-0 Original hydropathy-scale method underlying the default GRAVY interpretation.