Translate DNA to Protein in Seqqio: Frames, Codes, and Ambiguity
Translate one DNA sequence or a FASTA batch with an explicit NCBI genetic code, reading frame, and strand, then interpret stops and ambiguous codons correctly.
This workflow answers a narrower and more reviewable question than an annotation service: "What protein string does this nucleotide record produce under these exact settings?" Seqqio records the calculation as Seqqio-Translation-v1 and uses the NCBI gc.prt 4.6 table set. One sequence or an ordered FASTA batch can be analyzed without sending sequence data to a web form.
Choose the code, frame, and strand first
Open Translation. Choose Single sequence for one raw or FASTA record, or FASTA batch for independent records. Select the code that belongs to the biological source, then set Frame 1, 2, or 3 and Direct or Reverse strand. Paste the input, open a local file, or click Load example, then select Translate sequence.
| Control | Question it answers | Common mistake |
|---|---|---|
| NCBI code | Which amino acid or stop is assigned to each codon? | Assuming table 1 applies to every organelle or organism |
| Frame 1, 2, or 3 | Should translation start at nucleotide 1, 2, or 3? | Treating the three offsets as interchangeable |
| Direct or Reverse | Which 5-prime-to-3-prime orientation is translated? | Reverse-reading the text without complementing it |
| Single or batch | Is one record analyzed or are FASTA records kept independent? | Expecting a codon to cross a FASTA-record boundary |
Reproduce the built-in translation example
The built-in single-sequence example is synthetic_cds_1, an original software control rather than an organism reference. With Code 1, Frame 1, and Direct strand, the Seqqio engine accepted 903 bases and returned 301 protein symbols: 300 residues followed by a terminal stop. The output begins MRPFYLLARVTRQWSQLTLYPGRYKSFSMA and ends PPPCHATEMAQDSP*. These values were reproduced directly with the same Rust kernel used by the desktop app.
That result is useful as a first check because it connects every visible choice to a known output. A different frame changes the codon partition. Reverse strand first constructs the reverse complement and then applies the chosen frame. Changing the genetic code can change internal amino acids or stops. Seqqio does not silently search all six possibilities in this workspace; the selected run stays explicit.
Interpret stops, remainders, and ambiguity
| Input condition | Output rule |
|---|---|
| In-frame stop codon | Written as *; translation continues through later complete codons |
| One or two trailing bases | Ignored because they do not make a complete codon |
| Ambiguous codon whose concrete expansions all encode one residue | That shared amino acid is returned |
| Ambiguous codon with mixed amino-acid or stop outcomes | X is returned |
| Separate FASTA records | Translated independently; no codon crosses a record boundary |
The ambiguity rule is deliberately conservative. For example, an IUPAC codon is expanded conceptually only to determine whether all possible concrete codons agree. If they do not agree, X preserves uncertainty instead of selecting one interpretation. This differs from software that may emit ambiguity amino-acid symbols such as B, J, or Z in some mixed cases.
Keep translation separate from ORF detection
Translation does not require a start codon, stop at the first termination signal, validate a complete CDS, or locate coding regions. If you need start-to-stop candidates across frames, use the Seqqio ORF Finder guide. If you have a protein and need a DNA representation, use the Reverse Translation guide. Each tool answers a different question.
The genetic code must still be biologically justified. The NCBI genetic-code reference documents the table assignments and alternative initiators, while the Biopython sequence API provides an independent translation reference with selectable tables and stop behavior. Seqqio's implementation was exhaustively compared with Biopython 1.88 across its supported table and concrete-codon combinations.
When this translation workflow is a good fit
Use Translation for a traceable one-record conversion, a repeatable FASTA batch, teaching frame and strand effects, or checking output under a nonstandard code. It does not establish that a sequence is expressed, biologically functional, correctly annotated, or free of sequencing errors. Save the FASTA output and run metadata when the result will feed another analysis.
Translation is one of 39 applications in Seqqio 0.1.0 for Windows 64-bit. The Seqqio workspace overview explains the shared batch, history, and export model. The complete desktop toolkit is offered as a US$99 one-time purchase with no activation key.
References
- National Center for Biotechnology Information. The Genetic Codes NCBI Taxonomy genetic-code reference Authoritative translation-table assignments, amino-acid mappings, stops, and initiators.
- Biopython contributors. Bio.Seq module Official Biopython API documentation Independent translation API with selectable genetic codes and explicit stop/CDS behavior.